HORDB

ID: hor000954
Uniprot ID: P01353
Protein name: Gastrin
Gene name: GAST
Organism: Canis lupus familiaris (Dog) (Canis familiaris)
Family: Gastrin/cholecystokinin family
Source: Animal
Expression: NA
Disease: NA
Comments: NA
Taxonomy: Canis lupus (species), Canis (genus), Canidae (family), Caniformia (suborder), Carnivora (order), Laurasiatheria (superorder), Boreoeutheria, Eutheria, Theria, Mammalia (class), Amniota, Tetrapoda, Dipnotetrapodomorpha, Sarcopterygii (superclass), Euteleostomi, Teleostomi, Gnathostomata, Vertebrata, Craniata (subphylum), Chordata (phylum), Deuterostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
GO MF: GO:0005179 hormone activity
GO BP: GO:0007186 G protein-coupled receptor signaling pathway; GO:0032094 response to food
GO CC: GO:0005576 extracellular region; GO:0005615 extracellular space

Sequence: QGPWMEEEEAAYGWMDF
Length: 17(76-92)
Propeptide: MQRLCVYVLILALALATFSEASWKPRSRLQDAPSGPGANRGLEPHGLDQLGPASHHRRQLGLQGPPQLVADLSKKQGPWMEEEEAAYGWMDFGRRSAEEGDQRP
Signal peptide: MQRLCVYVLILALALATFSEA
Modification: T1 Pyrrolidone carboxylic acid;T12 Sulfotyrosine;T17 Phenylalanine amide
Glycosylation: NA
Mutagenesis: NA

Function: Gastrin stimulates the stomach mucosa to produce and secrete hydrochloric acid and the pancreas to secrete its digestive enzymes. It also stimulates smooth muscle contraction and increases blood circulation and water secretion in the stomach and intestine
Mechanism: NA
Cross BBB: NA
Target: NA
Target Unid: NA
IC50: NA
EC50: NA
ED50: NA
kd: NA
Half life: NA

Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)

hor000954_AF2.pdb

hor000954_ESM.pdb

Mass:	236181	Formula:	C94H122N20O30S2
Absent amino acids:	CHIKLNRSTV	Common amino acids:	E
pI:	3.26	Basic residues:	0
Polar residues:	3	Hydrophobic residues:	5
Hydrophobicity:	-95.88	Boman Index:	-2380
Half-Life:	0.8 hour	Half-Life Yeast:	10 min
Half-Life E.Coli:	>10 hour	Aliphatic Index	11.76
Instability Index:	9093.53	Extinction Coefficient cystines:	12490
Absorbance 280nm:	780.63