General Information

  • ID:  hor000954
  • Uniprot ID:  P01353
  • Protein name:  Gastrin
  • Gene name:  GAST
  • Organism:  Canis lupus familiaris (Dog) (Canis familiaris)
  • Family:  Gastrin/cholecystokinin family
  • Source:  animal
  • Expression:  NA
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Canis lupus (species), Canis (genus), Canidae (family), Caniformia (suborder), Carnivora (order), Laurasiatheria (superorder), Boreoeutheria, Eutheria, Theria, Mammalia (class), Amniota, Tetrapoda, Dipnotetrapodomorpha, Sarcopterygii (superclass), Euteleostomi, Teleostomi, Gnathostomata, Vertebrata, Craniata (subphylum), Chordata (phylum), Deuterostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  GO:0005179 hormone activity
  • GO BP:  GO:0007186 G protein-coupled receptor signaling pathway; GO:0032094 response to food
  • GO CC:  GO:0005576 extracellular region; GO:0005615 extracellular space

Sequence Information

  • Sequence:  QGPWMEEEEAAYGWMDF
  • Length:  17
  • Propeptide:  MQRLCVYVLILALALATFSEASWKPRSRLQDAPSGPGANRGLEPHGLDQLGPASHHRRQLGLQGPPQLVADLSKKQGPWMEEEEAAYGWMDFGRRSAEEGDQRP
  • Signal peptide:  MQRLCVYVLILALALATFSEA
  • Modification:  T1 Pyrrolidone carboxylic acid;T12 Sulfotyrosine;T17 Phenylalanine amide
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  Gastrin stimulates the stomach mucosa to produce and secrete hydrochloric acid and the pancreas to secrete its digestive enzymes. It also stimulates smooth muscle contraction and increases blood circulation and water secretion in the stomach and intestine.
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:  NA
  • IC50: NA
  • EC50: NA
  • ED50: NA
  • kd: NA
  • Half life: NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  AF-P01353-F1(AlphaFold_DB_ID)

  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
    •    hor000954_AF2.pdbhor000954_ESM.pdb

Physical Information

Mass: 236181 Formula: C94H122N20O30S2
Absent amino acids: CHIKLNRSTV Common amino acids: E
pI: 3.26 Basic residues: 0
Polar residues: 3 Hydrophobic residues: 5
Hydrophobicity: -95.88 Boman Index: -2380
Half-Life: 0.8 hour Half-Life Yeast: 10 min
Half-Life E.Coli: >10 hour Aliphatic Index 11.76
Instability Index: 9093.53 Extinction Coefficient cystines: 12490
Absorbance 280nm: 780.63

Literature

  • PubMed ID:  5799207
  • Title:  Structure and synthesis of canine gastrin.